RABL4 Blocking Peptide (33R-7831)
A synthetic peptide for use as a blocking control in assays to test for specificity of RABL4 antibody, catalog no. 70R-5863
Overview
Overview
| Synonyms | RABL4 control peptide, RABL4 antibody Blocking Peptide, Anti-RABL4 Blocking Peptide, Rab Member Of Ras Oncogene Family-Like 4 Blocking Peptide, RAYL Blocking Peptide, RABL4, RABL-4, RABL 4, RABL-4 Blocking Peptide, RABL 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA |
|---|---|
| Molecular Weight | 20 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product