RABL4 Blocking Peptide (33R-7831)

A synthetic peptide for use as a blocking control in assays to test for specificity of RABL4 antibody, catalog no. 70R-5863

Synonyms RABL4 control peptide, RABL4 antibody Blocking Peptide, Anti-RABL4 Blocking Peptide, Rab Member Of Ras Oncogene Family-Like 4 Blocking Peptide, RAYL Blocking Peptide, RABL4, RABL-4, RABL 4, RABL-4 Blocking Peptide, RABL 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
Molecular Weight 20 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors