RAD17 Blocking Peptide (33R-7392)

A synthetic peptide for use as a blocking control in assays to test for specificity of RAD17 antibody, catalog no. 20R-1062

Synonyms RAD17 control peptide, RAD17 antibody Blocking Peptide, Anti-RAD17 Blocking Peptide, RAD17 homolog, S. pombe Blocking Peptide, CCYC Blocking Peptide, HRAD17 Blocking Peptide, R24L Blocking Peptide, RAD17Sp Blocking Peptide, Rad24 Blocking Peptide, RAD17, RAD-17, RAD 17, RAD-17 Blocking Peptide, RAD 17 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT
Molecular Weight 66 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors