RAD17 Blocking Peptide (33R-7392)
A synthetic peptide for use as a blocking control in assays to test for specificity of RAD17 antibody, catalog no. 20R-1062
Overview
Overview
| Synonyms | RAD17 control peptide, RAD17 antibody Blocking Peptide, Anti-RAD17 Blocking Peptide, RAD17 homolog, S. pombe Blocking Peptide, CCYC Blocking Peptide, HRAD17 Blocking Peptide, R24L Blocking Peptide, RAD17Sp Blocking Peptide, Rad24 Blocking Peptide, RAD17, RAD-17, RAD 17, RAD-17 Blocking Peptide, RAD 17 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT |
|---|---|
| Molecular Weight | 66 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product