RAD23A antibody (70R-1037)

Rabbit polyclonal RAD23A antibody

Synonyms Polyclonal RAD23A antibody, Anti-RAD23A antibody, RADA-23 antibody, HHR23A antibody, RAD23A, RADA 23 antibody, MGC111083 antibody, Rad23 Homolog A antibody, RADA-23, RADA 23
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ
Assay Information RAD23A Blocking Peptide, catalog no. 33R-3339, is also available for use as a blocking control in assays to test for specificity of this RAD23A antibody

Images

Western Blot analysis using RAD23A antibody (70R-1037)

RAD23A antibody (70R-1037) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RAD23A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAD23A is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAD23A antibody (70R-1037) | RAD23A antibody (70R-1037) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors