RAD23B Blocking Peptide (33R-7736)
A synthetic peptide for use as a blocking control in assays to test for specificity of RAD23B antibody, catalog no. 70R-3307
Overview
Overview
| Synonyms | RAD23B control peptide, RAD23B antibody Blocking Peptide, Anti-RAD23B Blocking Peptide, Rad23 Homolog B Blocking Peptide, HHR23B Blocking Peptide, HR23B Blocking Peptide, P58 Blocking Peptide, RAD23B, RADB-23, RADB 23, RADB-23 Blocking Peptide, RADB 23 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP |
|---|---|
| Molecular Weight | 43 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product