RAD23B Blocking Peptide (33R-7736)

A synthetic peptide for use as a blocking control in assays to test for specificity of RAD23B antibody, catalog no. 70R-3307

Synonyms RAD23B control peptide, RAD23B antibody Blocking Peptide, Anti-RAD23B Blocking Peptide, Rad23 Homolog B Blocking Peptide, HHR23B Blocking Peptide, HR23B Blocking Peptide, P58 Blocking Peptide, RAD23B, RADB-23, RADB 23, RADB-23 Blocking Peptide, RADB 23 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
Molecular Weight 43 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors