RAD9B Blocking Peptide (33R-8859)

A synthetic peptide for use as a blocking control in assays to test for specificity of RAD9B antibody, catalog no. 70R-5622

Synonyms RAD9B control peptide, RAD9B antibody Blocking Peptide, Anti-RAD9B Blocking Peptide, Rad9 Homolog B Blocking Peptide, FLJ40346 Blocking Peptide, MGC75426 Blocking Peptide, RAD9B, RADB-9, RADB 9, RADB-9 Blocking Peptide, RADB 9 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED
Molecular Weight 28 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RAD9B protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors