RAGE Blocking Peptide (33R-9325)
A synthetic peptide for use as a blocking control in assays to test for specificity of RAGE antibody, catalog no. 70R-9435
Overview
Overview
| Synonyms | RAGE control peptide, RAGE antibody Blocking Peptide, Anti-RAGE Blocking Peptide, renal tumor antigen Blocking Peptide, MOK Blocking Peptide, RAGE1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHR |
|---|---|
| Molecular Weight | 48 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RAGE is able to phosphorylate several exogenous substrates and to undergo autophosphorylation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product