RALY antibody (70R-2071)

Rabbit polyclonal RALY antibody raised against the N terminal of RALY

Synonyms Polyclonal RALY antibody, Anti-RALY antibody, RNA Binding Protein Autoantigenic antibody, Hnrnp-Associated With Lethal Yellow Homolog antibody
Specificity RALY antibody was raised against the N terminal of RALY
Cross Reactivity Human
Applications IHC, WB
Immunogen RALY antibody was raised using the N terminal of RALY corresponding to a region with amino acids NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ
Assay Information RALY Blocking Peptide, catalog no. 33R-6745, is also available for use as a blocking control in assays to test for specificity of this RALY antibody

Images

Western Blot analysis using RALY antibody (70R-2071)

RALY antibody (70R-2071) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RALY antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance In infectious mononucleosis, anti-EBNA-1 antibodies are produced which cross-react with multiple normal human proteins. The cross-reactivity is due to anti-gly/ala antibodies that cross-react with host proteins containing configurations like those in the EBNA-1 repeat. One such antigen is RALY which is a member of the heterogeneous nuclear ribonucleoprotein gene family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RALY antibody (70R-2071) | RALY antibody (70R-2071) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors