RALYL Blocking Peptide (33R-1450)

A synthetic peptide for use as a blocking control in assays to test for specificity of RALYL antibody, catalog no. 70R-4982

Synonyms RALYL control peptide, RALYL antibody Blocking Peptide, Anti-RALYL Blocking Peptide, RNA Binding Protein Autoantigenic Blocking Peptide, Raly Rna Binding Protein-Like Blocking Peptide, HNRPCL3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD
Molecular Weight 32 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RALYL belongs to the RRM HNRPC family, RALY subfamily. It contains 1 RRM (RNA recognition motif) domain. The functions of RALYL remain unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors