RALYL Blocking Peptide (33R-1450)
A synthetic peptide for use as a blocking control in assays to test for specificity of RALYL antibody, catalog no. 70R-4982
Overview
Overview
| Synonyms | RALYL control peptide, RALYL antibody Blocking Peptide, Anti-RALYL Blocking Peptide, RNA Binding Protein Autoantigenic Blocking Peptide, Raly Rna Binding Protein-Like Blocking Peptide, HNRPCL3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD |
|---|---|
| Molecular Weight | 32 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RALYL belongs to the RRM HNRPC family, RALY subfamily. It contains 1 RRM (RNA recognition motif) domain. The functions of RALYL remain unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product