Ran Blocking Peptide (33R-6771)
A synthetic peptide for use as a blocking control in assays to test for specificity of RAN antibody, catalog no. 70R-5529
Overview
Overview
| Synonyms | Ran control peptide, Ran antibody Blocking Peptide, Anti-Ran Blocking Peptide, Ran Member Ras Oncogene Family Blocking Peptide, ARA24 Blocking Peptide, Gsp1 Blocking Peptide, TC4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA |
|---|---|
| Molecular Weight | 24 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product