Ran Blocking Peptide (33R-6771)

A synthetic peptide for use as a blocking control in assays to test for specificity of RAN antibody, catalog no. 70R-5529

Synonyms Ran control peptide, Ran antibody Blocking Peptide, Anti-Ran Blocking Peptide, Ran Member Ras Oncogene Family Blocking Peptide, ARA24 Blocking Peptide, Gsp1 Blocking Peptide, TC4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA
Molecular Weight 24 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors