RAP1B antibody (70R-2677)

Rabbit polyclonal RAP1B antibody raised against the N terminal of RAP1B

Synonyms Polyclonal RAP1B antibody, Anti-RAP1B antibody, RAP 1, RAP 1 antibody, RAP1, RAL1B antibody, RAP-1, DKFZp586H0723 antibody, RAP-1 antibody, Rap1B Member Of Ras Oncogene Family antibody, K-REV antibody
Specificity RAP1B antibody was raised against the N terminal of RAP1B
Cross Reactivity Human,Mouse,Rat,Drosophila
Applications WB
Immunogen RAP1B antibody was raised using the N terminal of RAP1B corresponding to a region with amino acids MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ
Assay Information RAP1B Blocking Peptide, catalog no. 33R-6359, is also available for use as a blocking control in assays to test for specificity of this RAP1B antibody


Western Blot analysis using RAP1B antibody (70R-2677)

RAP1B antibody (70R-2677) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAP1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAP1B and RAP1A belong to a superfamily of RAS-like small GTP-binding proteins involved in cell signaling.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAP1B antibody (70R-2677) | RAP1B antibody (70R-2677) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors