RAP1GAP antibody (70R-2183)

Rabbit polyclonal RAP1GAP antibody raised against the middle region of RAP1GAP

Synonyms Polyclonal RAP1GAP antibody, Anti-RAP1GAP antibody, rap1GAPII antibody, RAP 1, RAP-1 antibody, RAP 1 antibody, RAP1, KIAA0474 antibody, RAP1GA1 antibody, RAP-1, Rap1 Gtpase Activating Protein antibody
Specificity RAP1GAP antibody was raised against the middle region of RAP1GAP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RAP1GAP antibody was raised using the middle region of RAP1GAP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA
Assay Information RAP1GAP Blocking Peptide, catalog no. 33R-3948, is also available for use as a blocking control in assays to test for specificity of this RAP1GAP antibody


Western Blot analysis using RAP1GAP antibody (70R-2183)

RAP1GAP antibody (70R-2183) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAP1GAP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAP1GAP antibody (70R-2183) | RAP1GAP antibody (70R-2183) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors