RAPSN antibody (70R-2650)

Rabbit polyclonal RAPSN antibody raised against the N terminal of RAPSN

Synonyms Polyclonal RAPSN antibody, Anti-RAPSN antibody, Receptor-Associated Protein Of The Synapse antibody, CMS1E antibody, CMS1D antibody, MGC3597 antibody
Specificity RAPSN antibody was raised against the N terminal of RAPSN
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen RAPSN antibody was raised using the N terminal of RAPSN corresponding to a region with amino acids MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLV
Assay Information RAPSN Blocking Peptide, catalog no. 33R-6061, is also available for use as a blocking control in assays to test for specificity of this RAPSN antibody


Western Blot analysis using RAPSN antibody (70R-2650)

RAPSN antibody (70R-2650) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAPSN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAPSN belongs to a family of proteins that are receptor associated proteins of the synapse. It contains a conserved cAMP-dependent protein kinase phosphorylation site. It is believed to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAPSN antibody (70R-2650) | RAPSN antibody (70R-2650) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors