RARB antibody (70R-1916)

Rabbit polyclonal RARB antibody raised against the C terminal of RARB

Synonyms Polyclonal RARB antibody, Anti-RARB antibody, Retinoic Acid Receptor Beta antibody, NR1B2 antibody, HAP antibody, RRB2 antibody
Specificity RARB antibody was raised against the C terminal of RARB
Cross Reactivity Human,Mouse
Applications WB
Immunogen RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS
Assay Information RARB Blocking Peptide, catalog no. 33R-8298, is also available for use as a blocking control in assays to test for specificity of this RARB antibody

Images

Western blot analysis using RARB antibody (70R-1916)

Recommended RARB Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RARB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RARB is a retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using RARB antibody (70R-1916) | Recommended RARB Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using RARB antibody (70R-1916) | Brain, Cortex

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors