RASGEF1A antibody (70R-5738)

Rabbit polyclonal RASGEF1A antibody raised against the N terminal of RASGEF1A

Synonyms Polyclonal RASGEF1A antibody, Anti-RASGEF1A antibody, CG4853 antibody, Rasgef Domain Family Member 1A antibody, FLJ37817 antibody
Specificity RASGEF1A antibody was raised against the N terminal of RASGEF1A
Cross Reactivity Human
Applications WB
Immunogen RASGEF1A antibody was raised using the N terminal of RASGEF1A corresponding to a region with amino acids TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL
Assay Information RASGEF1A Blocking Peptide, catalog no. 33R-9069, is also available for use as a blocking control in assays to test for specificity of this RASGEF1A antibody

Images

Western Blot analysis using RASGEF1A antibody (70R-5738)

RASGEF1A antibody (70R-5738) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RASGEF1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RASGEF1A is the guanine nucleotide exchange factor (GEF) for KRAS, HRAS, and NRAS (in vitro). It plays a role in cell migration.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RASGEF1A antibody (70R-5738) | RASGEF1A antibody (70R-5738) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors