RASGEF1C antibody (70R-5807)

Rabbit polyclonal RASGEF1C antibody raised against the middle region of RASGEF1C

Synonyms Polyclonal RASGEF1C antibody, Anti-RASGEF1C antibody, Rasgef Domain Family Member 1C antibody, FLJ35841 antibody
Specificity RASGEF1C antibody was raised against the middle region of RASGEF1C
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RASGEF1C antibody was raised using the middle region of RASGEF1C corresponding to a region with amino acids FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE
Assay Information RASGEF1C Blocking Peptide, catalog no. 33R-2957, is also available for use as a blocking control in assays to test for specificity of this RASGEF1C antibody

Images

Western Blot analysis using RASGEF1C antibody (70R-5807)

RASGEF1C antibody (70R-5807) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RASGEF1C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RASGEF1C is the guanine nucleotide exchange factor (GEF).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RASGEF1C antibody (70R-5807) | RASGEF1C antibody (70R-5807) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors