RBM14 antibody (70R-5675)

Rabbit polyclonal RBM14 antibody raised against the N terminal of RBM14

Synonyms Polyclonal RBM14 antibody, Anti-RBM14 antibody, COAA antibody, RBM-14 antibody, DKFZp779J0927 antibody, SYTIP1 antibody, RNA Binding Motif Protein 14 antibody, RBM 14 antibody, RBM 14, RBM-14, SIP antibody, RBM14
Specificity RBM14 antibody was raised against the N terminal of RBM14
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RBM14 antibody was raised using the N terminal of RBM14 corresponding to a region with amino acids YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD
Assay Information RBM14 Blocking Peptide, catalog no. 33R-10047, is also available for use as a blocking control in assays to test for specificity of this RBM14 antibody

Images

Western Blot analysis using RBM14 antibody (70R-5675)

RBM14 antibody (70R-5675) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM14 contains 2 RRM (RNA recognition motif) domains. Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RBM14 antibody (70R-5675) | RBM14 antibody (70R-5675) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors