RBM38 Blocking Peptide (33R-7794)

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM38 antibody, catalog no. 70R-4915

Synonyms RBM38 control peptide, RBM38 antibody Blocking Peptide, Anti-RBM38 Blocking Peptide, RNA Binding Motif Protein 38 Blocking Peptide, HSRNASEB Blocking Peptide, RNPC1 Blocking Peptide, SEB4B Blocking Peptide, SEB4D Blocking Peptide, dJ800J21.2 Blocking Peptide, RBM38, RBM-38, RBM 38, RBM-38 Blocking Peptide, RBM 38 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM
Molecular Weight 25 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM38 is a probable RNA-binding protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors