RBM38 Blocking Peptide (33R-7794)
A synthetic peptide for use as a blocking control in assays to test for specificity of RBM38 antibody, catalog no. 70R-4915
Overview
Overview
| Synonyms | RBM38 control peptide, RBM38 antibody Blocking Peptide, Anti-RBM38 Blocking Peptide, RNA Binding Motif Protein 38 Blocking Peptide, HSRNASEB Blocking Peptide, RNPC1 Blocking Peptide, SEB4B Blocking Peptide, SEB4D Blocking Peptide, dJ800J21.2 Blocking Peptide, RBM38, RBM-38, RBM 38, RBM-38 Blocking Peptide, RBM 38 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM |
|---|---|
| Molecular Weight | 25 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RBM38 is a probable RNA-binding protein. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product