RBM4 antibody (70R-4823)

Rabbit polyclonal RBM4 antibody raised against the middle region of RBM4

Synonyms Polyclonal RBM4 antibody, Anti-RBM4 antibody, MGC75138 antibody, LARK antibody, RBM-4, RBM-4 antibody, RBM4A antibody, DKFZp547K0918 antibody, RNA Binding Motif Protein 4 antibody, ZCRB3A antibody, RBM 4 antibody, RBM4, ZCCHC21 antibody, RBM 4
Specificity RBM4 antibody was raised against the middle region of RBM4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RBM4 antibody was raised using the middle region of RBM4 corresponding to a region with amino acids TAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPY
Assay Information RBM4 Blocking Peptide, catalog no. 33R-8981, is also available for use as a blocking control in assays to test for specificity of this RBM4 antibody


Western Blot analysis using RBM4 antibody (70R-4823)

RBM4 antibody (70R-4823) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM4 contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. RBM4 is down-regulated in fetal Down syndrome (DS) brain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RBM4 antibody (70R-4823) | RBM4 antibody (70R-4823) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors