RBM45 antibody (70R-4727)

Rabbit polyclonal RBM45 antibody raised against the middle region of RBM45

Synonyms Polyclonal RBM45 antibody, Anti-RBM45 antibody, RBM 45, RBM 45 antibody, RBM-45, RNA Binding Motif Protein 45 antibody, DRB1 antibody, RBM45, RBM-45 antibody, FLJ44612 antibody
Specificity RBM45 antibody was raised against the middle region of RBM45
Cross Reactivity Human,Rat
Applications WB
Immunogen RBM45 antibody was raised using the middle region of RBM45 corresponding to a region with amino acids MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT
Assay Information RBM45 Blocking Peptide, catalog no. 33R-6375, is also available for use as a blocking control in assays to test for specificity of this RBM45 antibody


Western Blot analysis using RBM45 antibody (70R-4727)

Western Blot showing RBM45 antibody used at a concentration of 1-2 ug/ml to detect its target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM45 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM45 is a RNA-binding protein with binding specificity for poly(C). It May play an important role in neural development. RBM45 contains 3 RRM (RNA recognition motif) domains.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RBM45 antibody (70R-4727) | Western Blot showing RBM45 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors