MAGEB2 Blocking Peptide (33R-1000)
A synthetic peptide for use as a blocking control in assays to test for specificity of RBM4B antibody, catalog no. 70R-1454
Overview
Overview
| Synonyms | RBM4B control peptide, RBM4B antibody Blocking Peptide, Anti-RBM4B Blocking Peptide, RNA Binding Motif Protein 4B Blocking Peptide, RBM4B, RBMB-4, RBMB 4, RBMB-4 Blocking Peptide, RBMB 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL |
|---|---|
| Molecular Weight | 39 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product