MAGEB2 Blocking Peptide (33R-1000)

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM4B antibody, catalog no. 70R-1454

Synonyms RBM4B control peptide, RBM4B antibody Blocking Peptide, Anti-RBM4B Blocking Peptide, RNA Binding Motif Protein 4B Blocking Peptide, RBM4B, RBMB-4, RBMB 4, RBMB-4 Blocking Peptide, RBMB 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL
Molecular Weight 39 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors