RBMS3 antibody (70R-1318)

Rabbit polyclonal RBMS3 antibody raised against the C terminal of RBMS3

Synonyms Polyclonal RBMS3 antibody, Anti-RBMS3 antibody, RBMS-3, RBMS 3 antibody, RBMS-3 antibody, RBMS 3, RNA Binding Motif Single Stranded Interacting Protein 3 antibody, RBMS3
Specificity RBMS3 antibody was raised against the C terminal of RBMS3
Cross Reactivity Human,Dog
Applications WB
Immunogen RBMS3 antibody was raised using the C terminal of RBMS3 corresponding to a region with amino acids TAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKP
Assay Information RBMS3 Blocking Peptide, catalog no. 33R-8991, is also available for use as a blocking control in assays to test for specificity of this RBMS3 antibody


Western Blot analysis using RBMS3 antibody (70R-1318)

RBMS3 antibody (70R-1318) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RBMS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RBMS3 antibody (70R-1318) | RBMS3 antibody (70R-1318) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors