RBP1 antibody (70R-1274)

Rabbit polyclonal RBP1 antibody raised against the middle region of RBP1

Synonyms Polyclonal RBP1 antibody, Anti-RBP1 antibody, RBPC antibody, CRABP-I antibody, CRBP1 antibody, Retinol Binding Protein 1 Cellular antibody, CRBP antibody
Specificity RBP1 antibody was raised against the middle region of RBP1
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG
Assay Information RBP1 Blocking Peptide, catalog no. 33R-4007, is also available for use as a blocking control in assays to test for specificity of this RBP1 antibody


Western Blot analysis using RBP1 antibody (70R-1274)

RBP1 antibody (70R-1274) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RBP1 antibody (70R-1274) | RBP1 antibody (70R-1274) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors