RBPMS Blocking Peptide (33R-7880)

A synthetic peptide for use as a blocking control in assays to test for specificity of RBPMS antibody, catalog no. 70R-4898

Synonyms RBPMS control peptide, RBPMS antibody Blocking Peptide, Anti-RBPMS Blocking Peptide, RNA Binding Protein With Multiple Splicing Blocking Peptide, HERMES Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFD
Molecular Weight 22 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors