RBPMS Blocking Peptide (33R-7880)
A synthetic peptide for use as a blocking control in assays to test for specificity of RBPMS antibody, catalog no. 70R-4898
Overview
Overview
| Synonyms | RBPMS control peptide, RBPMS antibody Blocking Peptide, Anti-RBPMS Blocking Peptide, RNA Binding Protein With Multiple Splicing Blocking Peptide, HERMES Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFD |
|---|---|
| Molecular Weight | 22 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product