RCC2 Blocking Peptide (33R-7978)

A synthetic peptide for use as a blocking control in assays to test for specificity of RCC2 antibody, catalog no. 70R-3169

Synonyms RCC2 control peptide, RCC2 antibody Blocking Peptide, Anti-RCC2 Blocking Peptide, Regulator Of Chromosome Condensation 2 Blocking Peptide, DKFZp762N0610 Blocking Peptide, KIAA1470 Blocking Peptide, TD-60 Blocking Peptide, RCC2, RCC-2, RCC 2, RCC-2 Blocking Peptide, RCC 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT
Molecular Weight 56 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors