RCC2 Blocking Peptide (33R-7978)
A synthetic peptide for use as a blocking control in assays to test for specificity of RCC2 antibody, catalog no. 70R-3169
Overview
Overview
| Synonyms | RCC2 control peptide, RCC2 antibody Blocking Peptide, Anti-RCC2 Blocking Peptide, Regulator Of Chromosome Condensation 2 Blocking Peptide, DKFZp762N0610 Blocking Peptide, KIAA1470 Blocking Peptide, TD-60 Blocking Peptide, RCC2, RCC-2, RCC 2, RCC-2 Blocking Peptide, RCC 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT |
|---|---|
| Molecular Weight | 56 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product