RCHY1 antibody (70R-2245)

Rabbit polyclonal RCHY1 antibody raised against the N terminal of RCHY1

Synonyms Polyclonal RCHY1 antibody, Anti-RCHY1 antibody, RNF199 antibody, RCHY-1 antibody, Ring Finger And Chy Zinc Finger Domain Containing 1 antibody, ZNF363 antibody, CHIMP antibody, RCHY 1, DKFZp586C1620 antibody, PIRH2 antibody, RCHY 1 antibody, ARNIP antibody, RCHY1, RCHY-1, hARNIP antibody, PRO1996 antibody
Specificity RCHY1 antibody was raised against the N terminal of RCHY1
Cross Reactivity Human
Applications WB
Immunogen RCHY1 antibody was raised using the N terminal of RCHY1 corresponding to a region with amino acids KLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEY
Assay Information RCHY1 Blocking Peptide, catalog no. 33R-4551, is also available for use as a blocking control in assays to test for specificity of this RCHY1 antibody


Western Blot analysis using RCHY1 antibody (70R-2245)

RCHY1 antibody (70R-2245) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RCHY1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RCHY1 has ubiquitin-protein ligase activity. This protein binds with p53 and promotes the ubiquitin-mediated proteosomal degradation of p53. This gene is oncogenic because loss of p53 function contributes directly to malignant tumor development. Transcription of this gene is regulated by p53.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RCHY1 antibody (70R-2245) | RCHY1 antibody (70R-2245) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors