RDBP Blocking Peptide (33R-7738)

A synthetic peptide for use as a blocking control in assays to test for specificity of RDBP antibody, catalog no. 70R-4630

Synonyms RDBP control peptide, RDBP antibody Blocking Peptide, Anti-RDBP Blocking Peptide, Rd Rna Binding Protein Blocking Peptide, D6S45 Blocking Peptide, NELF-E Blocking Peptide, RD Blocking Peptide, RDP Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNS
Molecular Weight 43 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RDBP is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors