RDH10 Blocking Peptide (33R-7732)

A synthetic peptide for use as a blocking control in assays to test for specificity of RDH10 antibody, catalog no. 70R-7462

Synonyms RDH10 control peptide, RDH10 antibody Blocking Peptide, Anti-RDH10 Blocking Peptide, Retinol Dehydrogenase 10 Blocking Peptide, All-Trans Blocking Peptide, RDH10, RDH-10, RDH 10, RDH-10 Blocking Peptide, RDH 10 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG
Molecular Weight 38 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RDH10 is a retinol dehydrogenase with a clear preference for NADP. RDH10 converts all-trans-retinol to all-trans-retinal. RDH10 has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors