RDH10 Blocking Peptide (33R-7732)
A synthetic peptide for use as a blocking control in assays to test for specificity of RDH10 antibody, catalog no. 70R-7462
Overview
Overview
| Synonyms | RDH10 control peptide, RDH10 antibody Blocking Peptide, Anti-RDH10 Blocking Peptide, Retinol Dehydrogenase 10 Blocking Peptide, All-Trans Blocking Peptide, RDH10, RDH-10, RDH 10, RDH-10 Blocking Peptide, RDH 10 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG |
|---|---|
| Molecular Weight | 38 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RDH10 is a retinol dehydrogenase with a clear preference for NADP. RDH10 converts all-trans-retinol to all-trans-retinal. RDH10 has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product