RDH12 Blocking Peptide (33R-3754)

A synthetic peptide for use as a blocking control in assays to test for specificity of RDH12 antibody, catalog no. 70R-5393

Synonyms RDH12 control peptide, RDH12 antibody Blocking Peptide, Anti-RDH12 Blocking Peptide, Retinol Dehydrogenase 12 Blocking Peptide, All-Trans/9-Cis/11-Cis Blocking Peptide, FLJ30273 Blocking Peptide, LCA3 Blocking Peptide, RDH12, RDH-12, RDH 12, RDH-12 Blocking Peptide, RDH 12 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues HIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAV
Molecular Weight 35 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RDH12 is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. RDH12 also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors