RDH12 Blocking Peptide (33R-3754)
A synthetic peptide for use as a blocking control in assays to test for specificity of RDH12 antibody, catalog no. 70R-5393
Overview
Overview
| Synonyms | RDH12 control peptide, RDH12 antibody Blocking Peptide, Anti-RDH12 Blocking Peptide, Retinol Dehydrogenase 12 Blocking Peptide, All-Trans/9-Cis/11-Cis Blocking Peptide, FLJ30273 Blocking Peptide, LCA3 Blocking Peptide, RDH12, RDH-12, RDH 12, RDH-12 Blocking Peptide, RDH 12 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | HIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAV |
|---|---|
| Molecular Weight | 35 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RDH12 is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. RDH12 also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product