RDH16 Blocking Peptide (33R-8550)
A synthetic peptide for use as a blocking control in assays to test for specificity of RDH16 antibody, catalog no. 70R-5493
Overview
Overview
| Synonyms | RDH16 control peptide, RDH16 antibody Blocking Peptide, Anti-RDH16 Blocking Peptide, Retinol Dehydrogenase 16 Blocking Peptide, All-Trans Blocking Peptide, RODH-4 Blocking Peptide, RDH16, RDH-16, RDH 16, RDH-16 Blocking Peptide, RDH 16 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV |
|---|---|
| Molecular Weight | 36 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RDH16 is an oxidoreductase with a preference for NAD. It oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. RDH16 has higher activity towards CRBP-bound retinol than with free retinol. It also oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. RDH16 can also catalyze the reverse reaction. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product