RDH16 Blocking Peptide (33R-8550)

A synthetic peptide for use as a blocking control in assays to test for specificity of RDH16 antibody, catalog no. 70R-5493

Synonyms RDH16 control peptide, RDH16 antibody Blocking Peptide, Anti-RDH16 Blocking Peptide, Retinol Dehydrogenase 16 Blocking Peptide, All-Trans Blocking Peptide, RODH-4 Blocking Peptide, RDH16, RDH-16, RDH 16, RDH-16 Blocking Peptide, RDH 16 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV
Molecular Weight 36 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RDH16 is an oxidoreductase with a preference for NAD. It oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. RDH16 has higher activity towards CRBP-bound retinol than with free retinol. It also oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. RDH16 can also catalyze the reverse reaction.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors