RDHE2 antibody (70R-4440)

Rabbit polyclonal RDHE2 antibody raised against the middle region of RDHE2

Synonyms Polyclonal RDHE2 antibody, Anti-RDHE2 antibody, RDHE2, RDHE 2, RDH-E2 antibody, Epidermal Retinal Dehydrogenase 2 antibody, RDH#2 antibody, RDHE-2, FLJ33105 antibody, RDHE 2 antibody, RDHE-2 antibody
Specificity RDHE2 antibody was raised against the middle region of RDHE2
Cross Reactivity Human
Applications WB
Immunogen RDHE2 antibody was raised using the middle region of RDHE2 corresponding to a region with amino acids AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT
Assay Information RDHE2 Blocking Peptide, catalog no. 33R-1208, is also available for use as a blocking control in assays to test for specificity of this RDHE2 antibody

Images

Western Blot analysis using RDHE2 antibody (70R-4440)

RDHE2 antibody (70R-4440) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RDHE2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of RDHE2 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RDHE2 antibody (70R-4440) | RDHE2 antibody (70R-4440) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors