Rec8 Blocking Peptide (33R-7641)
A synthetic peptide for use as a blocking control in assays to test for specificity of REC8 antibody, catalog no. 70R-5548
Overview
Overview
| Synonyms | Rec8 control peptide, Rec8 antibody Blocking Peptide, Anti-Rec8 Blocking Peptide, Rec8 Homolog Blocking Peptide, HR21spB Blocking Peptide, MGC950 Blocking Peptide, REC8L1 Blocking Peptide, Rec8p Blocking Peptide, Rec8, Rec-8, Rec 8, Rec-8 Blocking Peptide, Rec 8 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN |
|---|---|
| Molecular Weight | 62 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | REC8 is required during meiosis for separation of sister chromatids and homologous chromosomes. Proteolytic cleavage of REC8 on chromosome arms by separin during anaphase I allows for homologous chromosome separation in meiosis I and cleavage of REC8 on centromeres during anaphase II allows for sister chromatid separation in meiosis II. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product