Rec8 Blocking Peptide (33R-7641)

A synthetic peptide for use as a blocking control in assays to test for specificity of REC8 antibody, catalog no. 70R-5548

Synonyms Rec8 control peptide, Rec8 antibody Blocking Peptide, Anti-Rec8 Blocking Peptide, Rec8 Homolog Blocking Peptide, HR21spB Blocking Peptide, MGC950 Blocking Peptide, REC8L1 Blocking Peptide, Rec8p Blocking Peptide, Rec8, Rec-8, Rec 8, Rec-8 Blocking Peptide, Rec 8 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN
Molecular Weight 62 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance REC8 is required during meiosis for separation of sister chromatids and homologous chromosomes. Proteolytic cleavage of REC8 on chromosome arms by separin during anaphase I allows for homologous chromosome separation in meiosis I and cleavage of REC8 on centromeres during anaphase II allows for sister chromatid separation in meiosis II.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors