RELB antibody (70R-1286)

Rabbit polyclonal RELB antibody raised against the C terminal of RELB

Synonyms Polyclonal RELB antibody, Anti-RELB antibody, V-Rel Reticuloendotheliosis Viral Oncogene Homolog B antibody, I-REL antibody
Specificity RELB antibody was raised against the C terminal of RELB
Cross Reactivity Human,Mouse
Applications WB
Immunogen RELB antibody was raised using the C terminal of RELB corresponding to a region with amino acids GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT
Assay Information RELB Blocking Peptide, catalog no. 33R-3469, is also available for use as a blocking control in assays to test for specificity of this RELB antibody


Western Blot analysis using RELB antibody (70R-1286)

RELB antibody (70R-1286) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RELB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RELB neither associates with DNA nor with RELA/p65 or REL. It stimulates promoter activity in the presence of NFKB2/p49.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RELB antibody (70R-1286) | RELB antibody (70R-1286) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors