RGS12 antibody (70R-3110)

Rabbit polyclonal RGS12 antibody raised against the n terminal of RGS12

Synonyms Polyclonal RGS12 antibody, Anti-RGS12 antibody, RGS-12 antibody, RGS 12 antibody, RGS-12, Regulator Of G-Protein Signaling 12 antibody, DKFZp761K1617 antibody, RGS 12, RGS12, DKFZp761K1817 antibody
Specificity RGS12 antibody was raised against the n terminal of RGS12
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RGS12 antibody was raised using the N terminal of RGS12 corresponding to a region with amino acids RSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVNEI
Assay Information RGS12 Blocking Peptide, catalog no. 33R-8216, is also available for use as a blocking control in assays to test for specificity of this RGS12 antibody

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RGS12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RGS12 is a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. RGS12 co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors