RGS16 antibody (70R-1260)

Rabbit polyclonal RGS16 antibody raised against the C terminal of RGS16

Synonyms Polyclonal RGS16 antibody, Anti-RGS16 antibody, RGS 16 antibody, RGS16, Regulator Of G-Protein Signalling 16 antibody, RGS-16, RGS 16, RGS-16 antibody
Specificity RGS16 antibody was raised against the C terminal of RGS16
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT
Assay Information RGS16 Blocking Peptide, catalog no. 33R-1842, is also available for use as a blocking control in assays to test for specificity of this RGS16 antibody


Western Blot analysis using RGS16 antibody (70R-1260)

RGS16 antibody (70R-1260) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RGS16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RGS16 belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RGS16 antibody (70R-1260) | RGS16 antibody (70R-1260) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors