RGS3 antibody (70R-1648)

Rabbit polyclonal RGS3 antibody raised against the C terminal of RGS3

Synonyms Polyclonal RGS3 antibody, Anti-RGS3 antibody, RGS 3, RGS3, Regulator Of G-Protein Signalling 3 antibody, RGS 3 antibody, RGS-3 antibody, RGS-3
Specificity RGS3 antibody was raised against the C terminal of RGS3
Cross Reactivity Human
Applications WB
Immunogen RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL


Western blot analysis using RGS3 antibody (70R-1648)

Tissue analyzed: HepG2 lysates; Antibody Dilution: 1.0ug/ml


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RGS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using RGS3 antibody (70R-1648) | Tissue analyzed: HepG2 lysates; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors