RHAG antibody (70R-1913)

Rabbit polyclonal RHAG antibody raised against the middle region of RHAG

Synonyms Polyclonal RHAG antibody, Anti-RHAG antibody, Rh50 antibody, RH2 antibody, RH50A antibody, Rh50 GP antibody, Rh-Associated Glycoprotein antibody
Specificity RHAG antibody was raised against the middle region of RHAG
Cross Reactivity Human
Applications WB
Immunogen RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG
Assay Information RHAG Blocking Peptide, catalog no. 33R-2899, is also available for use as a blocking control in assays to test for specificity of this RHAG antibody


Western Blot analysis using RHAG antibody (70R-1913)

RHAG antibody (70R-1913) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RHAG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30 kDa, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kDa, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RHAG antibody (70R-1913) | RHAG antibody (70R-1913) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors