RHCE Blocking Peptide (33R-8819)
A synthetic peptide for use as a blocking control in assays to test for specificity of RHCE antibody, catalog no. 70R-7493
Overview
Overview
| Synonyms | RHCE control peptide, RHCE antibody Blocking Peptide, Anti-RHCE Blocking Peptide, Rh Blood Group Ccee Antigens Blocking Peptide, CD240CE Blocking Peptide, MGC103977 Blocking Peptide, RH Blocking Peptide, RH30A Blocking Peptide, RHC Blocking Peptide, RHE Blocking Peptide, RHIXB Blocking Peptide, RHPI Blocking Peptide, Rh4 Blocking Peptide, RhIVb(J) Blocking Peptide, RhVI Blocking Peptide, RhVIII Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG |
|---|---|
| Molecular Weight | 29 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product