RHOBTB1 antibody (70R-5842)

Rabbit polyclonal RHOBTB1 antibody raised against the middle region of RHOBTB1

Synonyms Polyclonal RHOBTB1 antibody, Anti-RHOBTB1 antibody, MGC33841 antibody, Rho-Related Btb Domain Containing 1 antibody, KIAA0740 antibody, MGC33059 antibody
Specificity RHOBTB1 antibody was raised against the middle region of RHOBTB1
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen RHOBTB1 antibody was raised using the middle region of RHOBTB1 corresponding to a region with amino acids DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN
Assay Information RHOBTB1 Blocking Peptide, catalog no. 33R-2087, is also available for use as a blocking control in assays to test for specificity of this RHOBTB1 antibody

Images

Immunohistochemical staining using RHOBTB1 antibody (70R-5842)

RHOBTB1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHOBTB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RHOBTB1 belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using RHOBTB1 antibody (70R-5842) | RHOBTB1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using RHOBTB1 antibody (70R-5842) | RHOBTB1 antibody (70R-5842) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors