RHPN1 antibody (70R-2697)

Rabbit polyclonal RHPN1 antibody raised against the middle region of RHPN1

Synonyms Polyclonal RHPN1 antibody, Anti-RHPN1 antibody, RHPN1, RHPN 1 antibody, KIAA1929 antibody, ODF5 antibody, RHPN-1, RHPN 1, Rhophilin Rho Gtpase Binding Protein 1 antibody, RHPN-1 antibody, RHPN antibody
Specificity RHPN1 antibody was raised against the middle region of RHPN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP
Assay Information RHPN1 Blocking Peptide, catalog no. 33R-8917, is also available for use as a blocking control in assays to test for specificity of this RHPN1 antibody


Western Blot analysis using RHPN1 antibody (70R-2697)

RHPN1 antibody (70R-2697) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHPN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RHPN1 has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RHPN1 antibody (70R-2697) | RHPN1 antibody (70R-2697) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors