Ribophorin I Blocking Peptide (33R-1015)
A synthetic peptide for use as a blocking control in assays to test for specificity of RPN1 antibody, catalog no. 70R-7108
Overview
Overview
| Synonyms | Ribophorin I control peptide, Ribophorin I antibody Blocking Peptide, Anti-Ribophorin I Blocking Peptide, DKFZp686B16177 Blocking Peptide, OST1 Blocking Peptide, RBPH1 Blocking Peptide, RPN1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKK |
|---|---|
| Molecular Weight | 66 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This protein is a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product