Ribophorin I Blocking Peptide (33R-1015)

A synthetic peptide for use as a blocking control in assays to test for specificity of RPN1 antibody, catalog no. 70R-7108

Synonyms Ribophorin I control peptide, Ribophorin I antibody Blocking Peptide, Anti-Ribophorin I Blocking Peptide, DKFZp686B16177 Blocking Peptide, OST1 Blocking Peptide, RBPH1 Blocking Peptide, RPN1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKK
Molecular Weight 66 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors