RIPK5 antibody (70R-2629)

Rabbit polyclonal RIPK5 antibody raised against the middle region of RIPK5

Synonyms Polyclonal RIPK5 antibody, Anti-RIPK5 antibody, RIPK-5 antibody, HDCMD38P antibody, KIAA0472 antibody, RIPK-5, RIPK 5, RIP5 antibody, DustyPK antibody, Receptor Interacting Protein Kinase 5 antibody, RIPK5, RIPK 5 antibody
Specificity RIPK5 antibody was raised against the middle region of RIPK5
Cross Reactivity Human
Applications WB
Immunogen RIPK5 antibody was raised using the middle region of RIPK5 corresponding to a region with amino acids EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS
Assay Information RIPK5 Blocking Peptide, catalog no. 33R-2341, is also available for use as a blocking control in assays to test for specificity of this RIPK5 antibody

Images

Western Blot analysis using RIPK5 antibody (70R-2629)

RIPK5 antibody (70R-2629) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 100 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RIPK5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RIPK5 antibody (70R-2629) | RIPK5 antibody (70R-2629) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors