RIT1 Blocking Peptide (33R-10324)

A synthetic peptide for use as a blocking control in assays to test for specificity of RIT1 antibody, catalog no. 70R-10368

Synonyms RIT1 control peptide, RIT1 antibody Blocking Peptide, Anti-RIT1 Blocking Peptide, Ras-like without CAAX 1 Blocking Peptide, MGC125864 Blocking Peptide, MGC125865 Blocking Peptide, RIBB Blocking Peptide, RIT Blocking Peptide, ROC1 Blocking Peptide, RIT1, RIT-1, RIT 1, RIT-1 Blocking Peptide, RIT 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues FHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFS
Molecular Weight 24 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RIT belongs to the RASssubfamily of small GTPases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors