RLBP1L1 Blocking Peptide (33R-6686)
A synthetic peptide for use as a blocking control in assays to test for specificity of RLBP1L1 antibody, catalog no. 70R-3100
Overview
Overview
| Synonyms | RLBP1L1 control peptide, RLBP1L1 antibody Blocking Peptide, Anti-RLBP1L1 Blocking Peptide, Retinaldehyde Binding Protein 1-Like 1 Blocking Peptide, CRALBPL Blocking Peptide, FLJ37248 Blocking Peptide, MGC34646 Blocking Peptide, RLBP1L1, RLBPL-1, RLBPL 1, RLBPL-1 Blocking Peptide, RLBPL 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDIL |
|---|---|
| Molecular Weight | 41 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RLBP1L1 contains 1 CRAL-TRIO domain. It may be used as a marker for human hepatocellular carcinomas. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product