RLBP1L1 Blocking Peptide (33R-6686)

A synthetic peptide for use as a blocking control in assays to test for specificity of RLBP1L1 antibody, catalog no. 70R-3100

Synonyms RLBP1L1 control peptide, RLBP1L1 antibody Blocking Peptide, Anti-RLBP1L1 Blocking Peptide, Retinaldehyde Binding Protein 1-Like 1 Blocking Peptide, CRALBPL Blocking Peptide, FLJ37248 Blocking Peptide, MGC34646 Blocking Peptide, RLBP1L1, RLBPL-1, RLBPL 1, RLBPL-1 Blocking Peptide, RLBPL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDIL
Molecular Weight 41 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RLBP1L1 contains 1 CRAL-TRIO domain. It may be used as a marker for human hepatocellular carcinomas.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors