RNASE9 antibody (70R-3186)

Rabbit polyclonal RNASE9 antibody

Synonyms Polyclonal RNASE9 antibody, Anti-RNASE9 antibody, h461 antibody, Ribonuclease Rnase A Family 9 antibody
Cross Reactivity Human
Applications WB
Immunogen RNASE9 antibody was raised using a synthetic peptide corresponding to a region with amino acids PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH
Assay Information RNASE9 Blocking Peptide, catalog no. 33R-7036, is also available for use as a blocking control in assays to test for specificity of this RNASE9 antibody


Western Blot analysis using RNASE9 antibody (70R-3186)

RNASE9 antibody (70R-3186) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNASE9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNASE9 belongs to the pancreatic ribonuclease family. It may be involved in host defense.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RNASE9 antibody (70R-3186) | RNASE9 antibody (70R-3186) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors