CAD Blocking Peptide (33R-1037)

A synthetic peptide for use as a blocking control in assays to test for specificity of RNASEN antibody, catalog no. 70R-4643

Synonyms RNASEN control peptide, RNASEN antibody Blocking Peptide, Anti-RNASEN Blocking Peptide, Ribonuclease Type Iii Nuclear Blocking Peptide, DROSHA Blocking Peptide, ETOHI2 Blocking Peptide, HSA242976 Blocking Peptide, RANSE3L Blocking Peptide, RN3 Blocking Peptide, RNASE3L Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK
Molecular Weight 159 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNASEN is a ribonuclease III double-stranded (ds) RNA-specific endoribonuclease that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcripts (pri-miRNAs) to release precursor miRNA (pre-miRNA) in the nucleus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors