CAD Blocking Peptide (33R-1037)
A synthetic peptide for use as a blocking control in assays to test for specificity of RNASEN antibody, catalog no. 70R-4643
Overview
Overview
| Synonyms | RNASEN control peptide, RNASEN antibody Blocking Peptide, Anti-RNASEN Blocking Peptide, Ribonuclease Type Iii Nuclear Blocking Peptide, DROSHA Blocking Peptide, ETOHI2 Blocking Peptide, HSA242976 Blocking Peptide, RANSE3L Blocking Peptide, RN3 Blocking Peptide, RNASE3L Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK |
|---|---|
| Molecular Weight | 159 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RNASEN is a ribonuclease III double-stranded (ds) RNA-specific endoribonuclease that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcripts (pri-miRNAs) to release precursor miRNA (pre-miRNA) in the nucleus. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product