RNF111 antibody (70R-2018)

Rabbit polyclonal RNF111 antibody raised against the C terminal of RNF111

Synonyms Polyclonal RNF111 antibody, Anti-RNF111 antibody, RNF111, ARK antibody, RNF-111, DKFZp313E0731 antibody, DKFZp686H1966 antibody, FLJ38008 antibody, RNF-111 antibody, RNF 111, Ring Finger Protein 111 antibody, DKFZp761D081 antibody, RNF 111 antibody
Specificity RNF111 antibody was raised against the C terminal of RNF111
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen RNF111 antibody was raised using the C terminal of RNF111 corresponding to a region with amino acids TIERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRRL
Assay Information RNF111 Blocking Peptide, catalog no. 33R-9114, is also available for use as a blocking control in assays to test for specificity of this RNF111 antibody

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNF111 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNF111 contains a RING finger domain, a motif known to be involved in protein-protein and protein-DNA interactions. The mouse counterpart of this gene (Rnf111/arkadia) has been shown to genetically interact with the transforming growth factor (TGF) beta-like factor Nodal, and act as a modulator of the nodal signaling cascade, which is essential for the induction of mesoderm during embryonic development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors