RNF121 antibody (70R-1778)

Rabbit polyclonal RNF121 antibody raised against the N terminal of RNF121

Synonyms Polyclonal RNF121 antibody, Anti-RNF121 antibody, RNF 121 antibody, RNF121, Ring Finger Protein 121 antibody, RNF-121, FLJ11099 antibody, RNF 121, RNF-121 antibody
Specificity RNF121 antibody was raised against the N terminal of RNF121
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen RNF121 antibody was raised using the N terminal of RNF121 corresponding to a region with amino acids WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG
Assay Information RNF121 Blocking Peptide, catalog no. 33R-10040, is also available for use as a blocking control in assays to test for specificity of this RNF121 antibody


Immunohistochemical staining using RNF121 antibody (70R-1778)

RNF121 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RNF121 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using RNF121 antibody (70R-1778) | RNF121 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using RNF121 antibody (70R-1778) | RNF121 antibody (70R-1778) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors