Rnf122 Blocking Peptide (33R-8592)

A synthetic peptide for use as a blocking control in assays to test for specificity of Rnf122 antibody, catalog no. 70R-8559

Synonyms Rnf122 control peptide, Rnf122 antibody Blocking Peptide, Anti-Rnf122 Blocking Peptide, ring finger protein 122 Blocking Peptide, 1110063C11Rik Blocking Peptide, Rnf122, Rnf-122, Rnf 122, Rnf-122 Blocking Peptide, Rnf 122 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGTCAVCLEDFKG
Molecular Weight 17 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors