RNF165 antibody (70R-1152)

Rabbit polyclonal RNF165 antibody raised against the N terminal of RNF165

Synonyms Polyclonal RNF165 antibody, Anti-RNF165 antibody, RNF165, RNF 165, RNF 165 antibody, Ring Finger Protein 165 antibody, RNF-165, RNF-165 antibody
Specificity RNF165 antibody was raised against the N terminal of RNF165
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen RNF165 antibody was raised using the N terminal of RNF165 corresponding to a region with amino acids MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP
Assay Information RNF165 Blocking Peptide, catalog no. 33R-6596, is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody


Western Blot analysis using RNF165 antibody (70R-1152)

RNF165 antibody (70R-1152) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RNF165 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RNF165 antibody (70R-1152) | RNF165 antibody (70R-1152) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors