RNF20 antibody (70R-2098)

Rabbit polyclonal RNF20 antibody raised against the N terminal of RNF20

Synonyms Polyclonal RNF20 antibody, Anti-RNF20 antibody, BRE1A antibody, RNF 20 antibody, Ring Finger Protein 20 antibody, FLJ20382 antibody, KIAA2779 antibody, MGC129667 antibody, RNF20, MGC129668 antibody, RNF-20, FLJ11189 antibody, RNF-20 antibody, RNF 20
Specificity RNF20 antibody was raised against the N terminal of RNF20
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RNF20 antibody was raised using the N terminal of RNF20 corresponding to a region with amino acids LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS
Assay Information RNF20 Blocking Peptide, catalog no. 33R-5103, is also available for use as a blocking control in assays to test for specificity of this RNF20 antibody


Western Blot analysis using RNF20 antibody (70R-2098)

RNF20 antibody (70R-2098) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 114 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNF20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNF20 shares similarity with BRE1 of S. cerevisiae. Yeast BRE1 is an ubiquitin ligase required for the ubiquitination of histone H2B and the methylation of histone H3.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RNF20 antibody (70R-2098) | RNF20 antibody (70R-2098) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors